DPCstruct | MC23415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 126 ± 13 aa |
| Standard deviation of domain lengths | 13.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183V784 | 1-127 | LFEIDDLQRMITNPADIRTLEMLDDDKITPRSQIQQQINEIVARQPQSVQNAYNMIVQNDRAKEEAELRMELQELRMRGASTAVLNA… |
| A0A3P7JTL0 | 1-141 | MRSFALLLVLLATFVYAYDPVHIDLLEDIVPTIEEETELDILEDDKNMIRSEKKKKFDEILAKEPENIKKLYAMELERAKLKHQAKF… |
| A0A0B2V534 | 44-163 | None |
| A0A183FJ13 | 13-118 | None |
| A0A368FKX5 | 1-140 | None |
| A0A1I7ZJ72 | 4-107 | None |
| A0A0N4Y2E4 | 13-123 | None |
| A0A1I8ANJ4 | 1-132 | None |
| A0A016UPQ8 | 62-194 | None |
| W2TEF4 | 27-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.