DPCstruct | MC23412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 100 ± 20 aa |
| Standard deviation of domain lengths | 20.26 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 41.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8Z966 | 280-371 | IYLNEKLRNKHKIKLDHKAEVFQCLNGAVSDVELRFKGREAYLQNTAYNTVPLVVHGNGRSKMVLNTLGNYLAKSWNSEDGCLSCWD… |
| A0A3P7JKE8 | 14-100 | IGLDSASRIFQNLNGVTDDVELQFDEDTGAALAYNAAYNTHPAILHGNGPSKSHLNYLANYIPGRWSSVSGCAFCGKKQKLDLSVGI |
| A0A2R7VYQ7 | 159-279 | None |
| A0A498LU56 | 459-552 | None |
| A0A812DKD3 | 184-306 | None |
| A0A195AZH6 | 196-288 | None |
| A0A1Y3BM60 | 58-186 | None |
| A0A6I9PVJ9 | 36-128 | None |
| A0A6P9AWG0 | 1-88 | None |
| B4DPX5 | 117-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.