DPCstruct | MC23411
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 129 ± 23 aa |
| Standard deviation of domain lengths | 23.29 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.29 |
| Pfam Score | 88.57 |
| Assigned Pfam label(s) | CL0237- PF19276 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0PHH4 | 183-302 | LPNGERAQVVETEWKAIVRGRGLDKSFLYDIVSNSHNGHDVDKMDYLLRDSKASGVAITFSETSLNRLFDHVRVVIDPISGLRRIGY… |
| A0A3P7JJP2 | 4-127 | KFVEEMISSENFDRSGVWLAETRGRPVEKAFLYDVVANSNDSIDVDKFEYLMRDSFCTGIPIPFNKHSIERLIENARVLPDPIRGFP… |
| A0A5B6ZAA4 | 7-95 | None |
| A0A177WV99 | 65-200 | None |
| A0A146H5Y0 | 91-184 | None |
| A0A397FLL1 | 111-234 | None |
| A0A1I8IIR1 | 756-860 | None |
| A0A498LHS7 | 7-126 | None |
| H0VBB6 | 236-377 | None |
| A0A6D2L1X7 | 153-291 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.