DPCstruct | MC23405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 164 ± 27 aa |
| Standard deviation of domain lengths | 27.03 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5PMJ6 | 1-197 | MSIPVATYRCTACDLSHWDSGTWGYRYYLCGVLKVPMRVAMGWCHACSNLGVVEVLPDAEGELERQGMLEALQAELGEVLGAIPPRK… |
| A0A2M8WZS9 | 1-179 | MSMPDGPLSCTDCDYRGFLVFRRITLAYHFADGTTVNGHREMRWCSDCRNPRDVEGAQPEIESLQTELDALNATFSTTGYRTKRWVS… |
| A0A517WA60 | 17-187 | None |
| A0A5C5XK46 | 5-129 | None |
| A0A6H9XU63 | 1-198 | None |
| A0A2E3GTZ4 | 6-135 | None |
| A0A5C6ESR4 | 4-133 | None |
| A0A3C1Z060 | 2-166 | None |
| A0A286HF39 | 22-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.