DPCstruct | MC23403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 115 ± 12 aa |
| Standard deviation of domain lengths | 11.85 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N7Q354 | 9-122 | DGGPTWDIDVHTNLNINVADAENGNQILSIVGQISGDQFPNAEGFVTDNDKNSIFLGAFQSKAGPNKGPFVTLMGDKKKPMFDVNIS… |
| A0A368JFW0 | 181-293 | AGTPDINVFSDFSVTENKKAGTLSISGKLTGDNFPSTEAFVTDPSGNNLFLGVGQIDAGVGRNTGPFTELPGENSTNSITNFNLTIT… |
| A0A4P5TL00 | 224-329 | None |
| A0A2E0TNH8 | 159-263 | None |
| A0A1Q3N2I5 | 569-686 | None |
| A0A0D0GI14 | 142-249 | None |
| A0A1I7D5S9 | 12-129 | None |
| A0A6S6N4E5 | 64-212 | None |
| A0A3N7GP86 | 51-161 | None |
| A0A1S1YXS5 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.