DPCstruct | MC23400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 8.59 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B3SGX1 | 155-237 | ADPSPKDGVAGWLEPSLASRLIAAEIPTLGKLVAVINEQGYWWFKLVPGVGEKVARSLATWLASPYIATSLKTTVGPHALKRH |
| W7W179 | 191-267 | QSPKAGDSVAAWLNPTLASHLEAADIFTLAQLVERINGVGRRWHAGIKAMGEGKALRIVEWLREHQDSIELQLGRHV |
| A0A158KT82 | 266-337 | None |
| A0A158KNM9 | 3-102 | None |
| A0A5C6TN37 | 1-93 | None |
| A0A228HMJ0 | 102-194 | None |
| A0A4Q3MJX5 | 134-214 | None |
| A0A0Q7HSW9 | 1-86 | None |
| A0A1G6LLA5 | 94-166 | None |
| A0A4Q3QFF1 | 4-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.