DPCstruct | MC2340
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Standard deviation of domain lengths | 8.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 49.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6RTK2 | 40-105 | LPLPPYITAEDVTFAVKAITVHAAEQWPDGPRCRNDRAPHPCRLHRWGRRVLIRRGLTEREIETLI |
| W7VME7 | 49-118 | LDDFPVFTPVSDEDVALAVRAVAVHVPERWPAGPLCRSERVPHPCRLARWGRSTLQAAGLTEERVDELVA |
| A0A1C6UHV4 | 4-77 | None |
| A0A1C4VXX0 | 4-79 | None |
| A0A1C6SH09 | 15-85 | None |
| A0A1Q7C310 | 6-94 | None |
| A0A1H3LYE2 | 13-86 | None |
| A0A561W8A4 | 4-74 | None |
| A0A3D5AQ73 | 6-99 | None |
| A0A3D4WR57 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.