DPCstruct | MC23397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 119 ± 16 aa |
| Standard deviation of domain lengths | 15.56 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 43.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812ZH41 | 185-311 | MQLPGPVVRWPHRAVTVMLLGGQDFFRGNLSAEEYMMRTCQCVGPSNTTTAFFYVPEMKHMPQDAVIQATLGCLVEAALDWSKGGLT… |
| A0A7S2QHT6 | 1-114 | QDYFRGGRSREEHFDDAKARVPAGNSRTAILYVNEMLHMPQTALLSAVLPGMLRTLMAWPCAAGAAAPRGDLEVVLAAAAESGCWSG… |
| A0A1Q9E697 | 565-679 | None |
| A0A813JXF1 | 1-155 | None |
| A0A813DVU0 | 23-137 | None |
| A0A812SQZ6 | 173-294 | None |
| A0A7S2VPF0 | 22-144 | None |
| A0A7S2F5E3 | 124-234 | None |
| A0A813LZY9 | 169-313 | None |
| A0A813AGI6 | 196-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.