DPCstruct | MC23394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 330 ± 28 aa |
| Standard deviation of domain lengths | 28.24 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813CTS9 | 121-430 | GLSLGDISRTVAALEQLLLEESLPLLRSSYFLNGLDHLDPATEHLPPPVAESQVHEVLLSYLLLFRHGLPRNLTDSESHQRLKQRAK… |
| A0A7S2Q360 | 4-376 | AAAADLFDGRADARGFSLEDVASLASVVEGFVTFESLEHLDAARELNHFTGAVLFSPQAQVLLTTMMLLFSSPGHNFTTVQERGLLH… |
| A0A1Q9E6L4 | 453-789 | None |
| A0A812RIL4 | 14-354 | None |
| A0A1Q9EGZ4 | 390-664 | None |
| A0A812TGR6 | 41-375 | None |
| A0A812NQU6 | 137-494 | None |
| A0A812KES5 | 153-477 | None |
| A0A1Q9EJN2 | 570-919 | None |
| A0A812XGR2 | 136-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.