DPCstruct | MC23389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 105 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7ZXL5 | 160-270 | RKEVEVARLQNEISAEVNRQIGEHQREFFLKEQLKVIQQELGLTKDDRSADLEQFQQRLASKTLPAAAQKRIDEEMGKLSILETGSP… |
| A0A7R8W3V6 | 1-102 | MTVVRLRIPSQPMSNRQDNWISLARKKQEELGDDLEELQNKLDNSQLPTHAYNVASKELQRLQRMSALSPEAGIIRSYVELFTELPW… |
| A0A4P0XXI5 | 46-161 | None |
| A0A6A5L4J7 | 4-91 | None |
| X1B817 | 89-194 | None |
| A0A4Z2B6M0 | 420-528 | None |
| A0A2V7SVH3 | 211-315 | None |
| A0A496SGT7 | 211-314 | None |
| W0B7C0 | 1-116 | None |
| A0A812T9W3 | 65-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.