DPCstruct | MC23388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 3.57 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 80.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A671STT2 | 1-68 | MNGQLDLSGKLIIKAQLGDDIRRIPIHNEDITYDELLLMMQRVFRGQLQSSDEVTIKYKDEDDDHITI |
| A0A7R8W1B6 | 12-71 | YQQLDLSGKLIIKVQLGDDVRRIPIHNEAITYDELVLMMQRVFRGRLSSSDEITIKYKDE |
| A0A452DKS6 | 1-67 | None |
| T0MK05 | 1-62 | None |
| A0A2K5DL66 | 1-68 | None |
| Q66KB5 | 1-68 | None |
| A0A6A4K1F6 | 60-119 | None |
| A0A7R8XAY3 | 25-92 | None |
| A0A444UEM0 | 1-70 | None |
| A0A4Y2DNH1 | 16-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.