DPCstruct | MC23387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 162 ± 14 aa |
| Standard deviation of domain lengths | 13.82 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 44.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8VZ97 | 1-159 | MDVAPIDRRKSKDIIADEGIEPWALRKSAILSKFTTSEKLSIVTSFLSGGEKVVVKAQSSVVDKVKNRLEQLDDFEEGSVRQMLDLS… |
| Q2KJ99 | 33-171 | DFEPWASKRGEILARYTTTEKLSINLFMGSEKGKAGTATSAMSEKVRTRLEELDDFEEGSQKELLNLTQQDYVNRIEELNQSLKDAW… |
| F1LCJ4 | 107-259 | None |
| A0A2B4RM35 | 93-255 | None |
| L1IBY7 | 1-184 | None |
| A0A6V7VM80 | 78-257 | None |
| A0A2J7QTV4 | 105-267 | None |
| A0A1A9YNH3 | 68-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.