DPCstruct | MC23386
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 166 ± 14 aa |
| Standard deviation of domain lengths | 14.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 43.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9JKC5 | 1-160 | FQDLRRDLQAVIGTRANFNIAQIENYGGETFLSEEVSIALLQESKLAFKRCQLLSRQSDLPGNAVQILESLLHYLMLEHVDYALDLG… |
| A0A7R8VZ60 | 54-213 | FQDLRRDLQAVIGTRTNFNIAQIENYGGETFLSEEVSIALLQESKLAFKRCQLLSRQSDLPGNAVQILESLLHYLMLEHVDYALDLG… |
| A0A0V0X822 | 361-528 | None |
| A0A1I8MW66 | 85-246 | None |
| A0A7R9B738 | 166-343 | None |
| A0A1B0A7H6 | 132-292 | None |
| A0A4C1TMV0 | 7-162 | None |
| A0A1B0AIQ2 | 70-257 | None |
| A0A0R3SMB1 | 2-137 | None |
| V9ILP2 | 144-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.