DPCstruct | MC23384
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 99 ± 11 aa |
| Standard deviation of domain lengths | 10.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L2PTV0 | 98-201 | ECPLEIHDVDEEINQQLLKDFTGERTGFVQVGPEKWFLPRKYKYQAGNFYSLEPRPDDTWIVTYPRSGTTWTQELVWLIANDLDYET… |
| A0A7R8VXJ1 | 10-106 | LVDLVNPAADKILQRSCSPTYPVGSLVVQPPGCVHTKLYRDYVDEIREFEVREDDIWIVSFPKCGTTWTQEMVWCINNDLNLNDARK… |
| A0A3Q0JEM9 | 3-103 | None |
| A0A6L5D2B9 | 2-94 | None |
| A0A653D9R2 | 4-75 | None |
| T1HB80 | 17-119 | None |
| A0A4C1ZB92 | 39-131 | None |
| A0A139WD58 | 23-120 | None |
| A0A7R9PSL7 | 107-215 | None |
| A0A0L7L630 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.