DPCstruct | MC23378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 207 ± 13 aa |
| Standard deviation of domain lengths | 13.07 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 71.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 42.06 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF17811- CL0229- PF02008 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9G1H8 | 190-389 | TEVESDICHTHLTPQELHGLKSIVLFLHILPANEKNVPQSIKDPIGLIKDVRTLVEQHRHDDHTLAITGKAVLGNILNTIDESPSTP… |
| A0A8B6FAC0 | 1-189 | MIEWLEDLPPSKKGIPKDLIDPEGVLREAKQLVMDHLQDNAQLAITGEAITYWPPSKKVIKPKKQYTSTGQKAPKATKGKLQKSEVV… |
| A0A1L8FFF5 | 136-331 | None |
| A0A1S3L5P6 | 236-468 | None |
| A0A4C1XRR2 | 457-668 | None |
| A1A5Z7 | 1-208 | None |
| A0A4U5U6U3 | 357-561 | None |
| A0A286Y5A9 | 11-208 | None |
| A0A151NSL0 | 117-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.