DPCstruct | MC23376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 89 ± 18 aa |
| Standard deviation of domain lengths | 17.52 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8HKU4 | 168-232 | QLTMVNTIVQSRQSKVTFNTSWLEDFYEKIVIETSAKRITPLVCNPGRVMLTCSRLYFQPFNNAD |
| A0A7R8VBV5 | 1-85 | MSAQLSVTLLGKYLRPRGLCFRKVIAAIVYSRQSRVSFDTLWLEDLYEKVVLETQGSKITPLVVNPGRILLTSSRLYFQPYNNIE |
| A0A817JDJ0 | 2-64 | None |
| A0A820X2E6 | 149-237 | None |
| B7PFE1 | 62-172 | None |
| A0A1X7TEY4 | 1-84 | None |
| A0A2R7VVC8 | 123-231 | None |
| A0A1X7SMT5 | 1-114 | None |
| A0A0L0DEH8 | 123-214 | None |
| A0A815DJF0 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.