DPCstruct | MC23371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Standard deviation of domain lengths | 8.79 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A856ZDJ7 | 81-141 | YAELPVIPNYVAEYIDYMKSSYRDIWDAIHYPFRSNKVDKYMEDNSETFARAWLDGYQTEE |
| A0A0R2L5F0 | 1-89 | MAYDGLSTRYSVASDAALPDDLPVIPKVVSEYIEDAKAGHYELLDAMTKWTLDQPVFDWIHDNSDTFARAWVLGIWRVEETGEIVKL… |
| A0A7T9MN13 | 1-72 | None |
| A0A116RAZ7 | 21-102 | None |
| I0S8X0 | 43-115 | None |
| A0A654XNH5 | 2-79 | None |
| A0A7X3BPA2 | 2-62 | None |
| A0A7Y6UTE4 | 4-79 | None |
| A0A7X2Y2Z3 | 2-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.