DPCstruct | MC2337
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 139 ± 25 aa |
| Standard deviation of domain lengths | 25.41 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9P6M1 | 224-374 | IEIKEDGSYKLNLDYFSFHYADKMPSKKLCKLLDGKIRKPGTELTEKHKDIAAALQLITEEVITKILNQVYNETKCENIVLAGGVAL… |
| A0A449IG18 | 3-114 | GAKREGDIADEPYIHYAASMQALFEKLSLQMIDYYLGDILKETGKIAFAGGCALNVKLNQKIIARPEVKELFVQPASGDAGTAVGAA… |
| A0A7W8XL03 | 93-247 | None |
| A0A2D5ZP13 | 447-593 | None |
| A0A833HKM5 | 610-775 | None |
| A0A349YS51 | 104-187 | None |
| A0A6I1Z9Z2 | 108-247 | None |
| A0A662QT51 | 40-150 | None |
| A0A7C7YH96 | 54-219 | None |
| A0A1V1PFF9 | 2-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.