DPCstruct | MC23369
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 74 ± 6 aa |
| Standard deviation of domain lengths | 5.64 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2U4U2 | 3-81 | SVVPQVDVRIAGKSLQTRITILVVDKTELMIWELKDDSLKDSYEAEGVAAYSNNKSIASSYASIFENPWKQTELYQKLE |
| A0A533UGD2 | 4-81 | GEPSRFRASILLVDRKFVLYVELKDDTKYTSYEAIGLSLFSSIRSTVISYVTIFETMWKQQELYQQLSRMQKQIETYE |
| A0A557STT0 | 409-476 | None |
| A0A6A7LMB6 | 8-74 | None |
| A0A842Q4T2 | 60-129 | None |
| A0A2V2U8P5 | 19-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.