DPCstruct | MC23362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 141 ± 8 aa |
| Standard deviation of domain lengths | 7.52 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 76.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 70.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438EU22 | 1-130 | MLAKEVIEDSLLSFLTQEAPNVEVDGEPTSQKVLSKIKIGSASLALLAKTALMAKYVSKGEGKSWTYQKAKSMISESVEMSQSIDWK… |
| A0A2G5DVT7 | 198-342 | MAGRGTDIILGGNPKMLAKEVMEDSLLSFLTQEAPNVEIDGEPISQKGLAKIKVGPSSMALLAKTALMAKYVRKSEGNKWSYQHAKS… |
| A0A453HJG5 | 105-249 | None |
| A0A453HJG3 | 119-263 | None |
| A0A453HJF8 | 52-196 | None |
| A0A453HJF3 | 1-146 | None |
| A0A2R6RPC9 | 105-249 | None |
| A0A2C9WER3 | 216-360 | None |
| A0A453HJB3 | 217-361 | None |
| A0A7J0GG90 | 33-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.