DPCstruct | MC23361
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 127 ± 12 aa |
| Standard deviation of domain lengths | 11.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438ETP3 | 1-138 | MPFQGVGHQKGYDQFNRVLMGLLQRVLDTNKRVQEAACSAFATLEEEAAEELTPHVAIILQHLLCAFGRYQKRNLRILYDAIGTLAD… |
| A0A1D6JIU9 | 3-114 | VLRRILDTNKRVQEAACSAFAILEEEASEELVPHLEVILQHLMCAYRKYQRRNLRILYDALGTLADAVGAELNQAKYLDIFMPPLIT… |
| A0A0M3J3T3 | 15-149 | None |
| A0A2A6D398 | 824-951 | None |
| A0A812RRR9 | 585-723 | None |
| A0A4W2F3J8 | 685-807 | None |
| A0A093ZGP9 | 740-878 | None |
| A0A1V4JVV8 | 1-102 | None |
| A0A4Y7K1S4 | 667-796 | None |
| A0A3M7ICJ4 | 769-903 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.