DPCstruct | MC23360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 170 ± 30 aa |
| Standard deviation of domain lengths | 29.77 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D3E2R3 | 2-152 | LQVSGWLAELKTTISAGLDHRKILLEIIGDKFEKWNLKVRKEKAIYHTLNMLSLDVTKKCLVGEGWSPLFAAPEIQEALQRAAVDSN… |
| A0A7R9QKK4 | 44-184 | LKSRVKKICEGFRATLYPCPETPSDRREMIGGVVSRIEDLNTVLSQTTEHRHRVLVAAAKNIKNWFVKVRKIKAVYHTLNMFNLDVT… |
| A0A5J4WDZ1 | 145-317 | None |
| A0A368GFE0 | 2-186 | None |
| A0A1S9CMQ0 | 152-363 | None |
| A0A446MS09 | 179-357 | None |
| A0A821QEU5 | 2-149 | None |
| A0A0C2JFI5 | 215-433 | None |
| A0A6I9YPB8 | 101-268 | None |
| A0A0N5DB33 | 142-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.