DPCstruct | MC2336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 262 ± 25 aa |
| Standard deviation of domain lengths | 24.64 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2AI42 | 17-254 | TGFLKNVMRLAVYAVENGVLPDNIQMDELYRMWETKVVQKEALCDEDILYLQNCYMLLSRQLAPITAISLRATECKQSSISKDYMGT… |
| A0A4P6HMK7 | 4-247 | LPENAIEDQVAKRIKRSYSLLKYAINNNLQIDPSVIKGINEIKFGYDNKQEWDAEKSARLDSYILELTKVTYPTTLYTLKYTLESPF… |
| A0A3R8T9C0 | 2-253 | None |
| A0A7W5I9L5 | 14-292 | None |
| A0A525CT56 | 1-264 | None |
| A0A6L8W8G1 | 121-374 | None |
| A0A1K2F939 | 12-332 | None |
| A0A6S6UM86 | 16-298 | None |
| A0A2S7A141 | 2-236 | None |
| A0A0J1CQN6 | 23-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.