DPCstruct | MC23356
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 55 ± 7 aa |
| Standard deviation of domain lengths | 7.20 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A162LWN7 | 96-153 | KMTQKDLATRCNTTQGIVADFERGSATPDQKVLGSMERVLNVKLRGADIGAPKFPNKK |
| A0A438EIQ1 | 1-47 | MSQAELAKLINERPQVVQEYENGKAVPNQAVLAKMEKVLGVKLRGKI |
| A0A024GJT3 | 265-315 | None |
| A0A0B2VUE7 | 314-369 | None |
| A0A0D0V6Y6 | 1-69 | None |
| A0A0D3DU78 | 96-148 | None |
| A0A7S2UVN6 | 74-124 | None |
| A0A6I9JPF0 | 76-129 | None |
| A0A6L5CEZ4 | 66-135 | None |
| A0A816M637 | 100-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.