DPCstruct | MC23353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Standard deviation of domain lengths | 10.15 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 41.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0188 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A1V5B9 | 1-110 | MSKFEYPIMSRSEIVAILAESQIASISEHDLFNPNPEFISDLYAGLLFHIDVLREEDHGLLEFAALEQLENPDLHVESARMVKLYSR… |
| A0A438E785 | 1-109 | MSKFEYPMIPRSEIIAILNESKIATVYDEDLINPNPDFVSDLYTRLLIHLDSLQEDPGQVEFAALERLENPDWHRDSVRIMNLYSKI… |
| A0A2U1NIB4 | 1-109 | None |
| A0A3R6VE43 | 1-141 | None |
| A0A834L3T4 | 245-365 | None |
| A0A2G2X1B1 | 1-110 | None |
| A0A7N0SWH5 | 2-111 | None |
| A0A6A1V2V1 | 1-110 | None |
| A0A498JB18 | 1-102 | None |
| A0A287LVE7 | 35-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.