DPCstruct | MC23349
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 109 ± 14 aa |
| Standard deviation of domain lengths | 13.85 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0630 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R2BDX3 | 98-198 | NCGENLDCTSCTESEKCVWCNVDKICVNGDFYGPMNGECGDYSWFECSFPGCEEYLDCQTCIADTSCGWCTIGHFCYEGSAVLKGDC… |
| A0A0S4IJI9 | 85-188 | ATSCTECTGVSQCGWCTYSNTCQSGNQTGSFTGCTAPYWHWTQQSCPATPAPTANCAPATTCLSCTQLGGCGWCSFSNQCQSGNASA… |
| A0A2E0TT32 | 919-1009 | None |
| A0A1Y3BLI1 | 372-493 | None |
| A0A356TC63 | 442-548 | None |
| A0A521UHV4 | 118-227 | None |
| T1GWQ7 | 48-168 | None |
| A0A7S4II02 | 5-118 | None |
| A2DQT4 | 5-158 | None |
| A0A3F2RM92 | 43-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.