DPCstruct | MC23347
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 263 ± 44 aa |
| Standard deviation of domain lengths | 43.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9UXD1 | 1-229 | MADKRKLQTEIDRVLKQVSEHSEIFEDTYDKIQTATNSNQKEKFEAELKKEIKKLQKFREQIKSWLNSSDAKSMAKVLGETRKLIEN… |
| A0A1R2AZ55 | 1-233 | MAKVRQQQQELEKKLAQVDEGYSNFNQIIKKINSAVNQTQKERFEGELKKEIKKLQRTRESLRNYESQDPRNKSRITEARKKIEELM… |
| A0A7J6Q3D4 | 1-310 | None |
| U6LK24 | 1-323 | None |
| A0A4S2MQD2 | 3-255 | None |
| A0A819ZX06 | 1-263 | None |
| A0A388KUV1 | 1-273 | None |
| A0A7J6TYL3 | 67-326 | None |
| A0A0G4LWS9 | 2-262 | None |
| A0A482S3D6 | 1-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.