DPCstruct | MC23344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 123 ± 22 aa |
| Standard deviation of domain lengths | 22.17 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R2AR81 | 1-116 | MGRKNKHKVKFLKPFCYYCDRDFDDEFVLHQHQKARHFSCHACHKKFSTAASMATHVLQVHKEQVLKVPNAKAGRDAIELDIFGMDG… |
| A0A7R9K176 | 1-98 | MGRKKKKMSKPWCWYCNREFDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKETIDKVPNSLPNRSNIEIEIYGMEGIPP… |
| Q5CT30 | 1-104 | None |
| A0A146H8R3 | 9-168 | None |
| A0A034W8Q6 | 1-106 | None |
| A0A1R3JAP5 | 587-689 | None |
| Q653D5 | 1-119 | None |
| A0A3N4LN30 | 3-149 | None |
| A0A7J6GE91 | 1-116 | None |
| A0A364N266 | 436-586 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.