DPCstruct | MC23342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 217 ± 36 aa |
| Standard deviation of domain lengths | 36.47 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12400 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4V2C0 | 9-177 | CRLDGFLSFSIQIIMGSFAFASLIIKWRQETPRRAPLIWLFDTFKQGSGLLLQHFTNLLFSIIAGQYLHQNSCAWYMCSHIVDSIVG… |
| A0A1R2AN15 | 14-204 | IFGDFGWFIQGTLGLLSFSSLVIKRYMEKNPRTWKIWFMDASKQATSAGILHVLNLYLSHSVKSGDQCVWYFLNYTVDTILGMALCY… |
| A0A1J8QJG4 | 11-240 | None |
| A0A7S1FJ89 | 17-279 | None |
| G4TH69 | 3-174 | None |
| A0A397F5D7 | 27-220 | None |
| A0A835NTS3 | 7-184 | None |
| U6KGA5 | 32-192 | None |
| A0A1X2G7L0 | 9-200 | None |
| A0A1J1IQG9 | 8-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.