DPCstruct | MC23341
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 3.52 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 43.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3M7B6 | 9-68 | LAILASKSRDNSRTPMQWSNGDNAGFTAGEPWIGLGDNYQQINVEAALADDSSVFYTYQK |
| L8WS64 | 250-313 | NMSDIMDGINRKARDNARVPMQWDDSSHAGFTSGKPWMRVNDNYKQINAKSQIDDERSIFSFWK |
| A0A265E6B4 | 1-64 | None |
| A0A4Q2HR45 | 85-144 | None |
| A0A564TZ70 | 126-178 | None |
| A0A4P8QQW9 | 57-115 | None |
| A0A0V1Q6A4 | 1-59 | None |
| A0A7Z1S7I8 | 44-107 | None |
| A0A489F4V6 | 89-152 | None |
| A0A507BJD3 | 106-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.