DPCstruct | MC23339
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 64 ± 3 aa |
| Standard deviation of domain lengths | 3.32 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3LXG2 | 1-66 | MRRMDRISGRSDDMLIIRGVNVFPSQLEEEIVKFEHISPHYQLEVNRRGHLDSLSVKVELKESSLT |
| A0A6I2JA68 | 14-79 | MRRIGKITGRSDDMLIVCGVNMFPTQVEELVLKIAQLAPHYQLVLSRSGNMDELEILTEVRAEFST |
| A0A2E8YG90 | 133-194 | None |
| A0A1V4GLJ6 | 8-74 | None |
| A0A645HL84 | 1-63 | None |
| A0A6L5DFZ3 | 441-499 | None |
| A0A377E4X3 | 1-62 | None |
| A0A850SVP0 | 244-306 | None |
| A0A7X5DHY9 | 31-91 | None |
| A0A7C3ADH4 | 3-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.