DPCstruct | MC23336
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 7.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 53.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3KFJ9 | 11-95 | FEGWAKDEAQALAILEQGEVNFIPCHHVNAVGPMGGITSASMPMLVVENVTDGNRAYCNLNEGIGKVMRFAAYGEDVLTRPSAGC |
| C0CYT4 | 121-209 | QGAVIGALLYEGRAADEGEARQLAASGRITFSPCHEHSAVGPMAGIISPSMPVHIVENRTTGNRAYCSVNEGLGKVLRFGAFSSSVL… |
| A0A7T4YB16 | 6-105 | None |
| A0A377KB36 | 1-89 | None |
| A0A376W1P5 | 1-90 | None |
| A0A843RBP2 | 510-596 | None |
| A0A2X1MZB5 | 72-151 | None |
| A0A2X4YG22 | 2-71 | None |
| A0A6D0F3I5 | 59-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.