DPCstruct | MC23335
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 183 ± 25 aa |
| Standard deviation of domain lengths | 24.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023- PF06798 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F3WSD7 | 23-230 | SNEIHFSAFKQHPDYNSYKGRFNFIKVPYLLDYLEEEKIYLEQIEGLKDRSVLEPHTLSLVCLFSVMTRLRSSQAANYKDKKLSQIV… |
| A0A2X3KDK6 | 1-177 | MKVPYCLRISEEIKIYEKLLNHSELTHAPCAPGTLETLSRFSILSRLKEPENSSIYSKIRVYDGESLKDTDPKAKSYQEYRDYAGVD… |
| A0A6N6X8J6 | 1-164 | None |
| A0A6A5L5X0 | 727-879 | None |
| A0A5B8XLM0 | 364-575 | None |
| A0A379AFA1 | 19-222 | None |
| A0A2L2XED8 | 30-189 | None |
| A0A212DM27 | 1-148 | None |
| A0A7Z9RZL5 | 221-442 | None |
| A0A402GPY4 | 292-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.