DPCstruct | MC23334
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 114 ± 13 aa |
| Standard deviation of domain lengths | 13.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3KDE1 | 2-111 | LGDEGAANHNRLGGHYGEPGMQLFVYGREEGNDTRPSRYPARQTREASEAVARLNQVNPQQVIFAQQNPDVIDQGVFHNDVIAVSNR… |
| W7Q8B1 | 87-197 | FSDEGAANHTRLCGEHGEPGVHLFVYGRQAFGGRVEPRKFPARQTLEASQAVARQHGLRGDQAVFAQQHPDAIDAGVFHNDVIAVGN… |
| A0A2E9MWF4 | 38-154 | None |
| A0A376SK93 | 1-90 | None |
| A0A2X3KZF1 | 110-227 | None |
| A0A6D0ELR9 | 69-201 | None |
| A0A7H4N0Z6 | 1-96 | None |
| A0A812ZC05 | 931-1044 | None |
| A0A3S4E8K6 | 16-126 | None |
| A0A518GHL9 | 94-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.