DPCstruct | MC23333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 85 ± 3 aa |
| Standard deviation of domain lengths | 3.49 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 38.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9F725 | 84-168 | SRLVNSEWWERQLKAQRTRWREALLIALGNVNRGASSYASKQAIRDVKARRQSNFDYLNSRELENVETGERFSLIDKVMASISNP |
| A0A2X3KA03 | 3-82 | SPDWWGRKIWRLRCDWRENQLRAVGAVNKKAHAYVSASSLIEWQEQRRKNRDFFKSHELVDEDGNVSSLEDMINKSTSNP |
| A0A6N8K860 | 2-81 | None |
| A0A4U9D482 | 121-208 | None |
| A0A192CND0 | 73-156 | None |
| A0A3D8M8I7 | 36-121 | None |
| A0A4P0YQA3 | 269-358 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.