DPCstruct | MC2333
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 212 ± 14 aa |
| Standard deviation of domain lengths | 13.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0693 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A154TKR6 | 2-219 | TQRPALSGDAVQKMLGHCAFEPTEPKAAKNTYTAERFVWLTKLNNLRILEQGSERPLTDTERATLMDEPYRKSKLTYAQARKLLDLD… |
| A0A5M4D410 | 238-450 | FGQRRMYWPKSIVGRCELIPQRKRCERADRRAQSLRMLEEVNNLRLTDMGTGERRKLTDAERRKLLAELAGSKELTFDKMRELLDFG… |
| W4VJ47 | 57-288 | None |
| A0A4R0WIB6 | 56-275 | None |
| E9S0G5 | 117-341 | None |
| H1D477 | 1-223 | None |
| A0A432FAK8 | 1-219 | None |
| A0A1X4N9Z9 | 44-271 | None |
| R7KAN2 | 227-426 | None |
| A0A0X8KN88 | 380-578 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.