DPCstruct | MC23329
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 119 ± 5 aa |
| Standard deviation of domain lengths | 5.47 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08343- PF00317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A243A247 | 1-123 | MRHIELNNEITQMQDGFYQLHKDKEALEVFMEEARENTVHFNSVAERMEYMKEHDYYYNVLDEYSLEEVEGVYNIAYGENFEFQSYM… |
| A0A2X3JSV9 | 1-119 | MATTTAECLTQETMDYHALNAMLNLYDSAGRIQFDKDRQAVDAFIATHVRPNSVTFSSQQQRLNWLVNEGYYDESVLNRYSRDFVIT… |
| A0A447JDP0 | 1-110 | None |
| X8APP2 | 1-117 | None |
| A0A376L9M5 | 31-145 | None |
| A0A4U9KKI6 | 5-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.