DPCstruct | MC23327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 106 ± 14 aa |
| Standard deviation of domain lengths | 13.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 48.68 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0031- CL0493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378AVK4 | 68-163 | KQSAGGAAIIHFLGGIHEIYFPYVLMNPRLILAVILGGMTGVFTLTILNGGLVSPASPGSILAVLAMTPKGAYFANIAAIIAAMAVS… |
| A0A2X3JN78 | 2-94 | NPRLILAVILGGMTGVFTLTILGGGLVSPASPGSILAVLAMTPKGAYFANIAGVCAAMAVSFVVSAILLKTSKVKEEDDIEAATRRM… |
| A0A1Q9YEH9 | 105-230 | None |
| A0A1Q6U7E7 | 3-117 | None |
| A0A7X7QE60 | 13-105 | None |
| A0A7X2MDX8 | 57-160 | None |
| A0A516KKC3 | 244-341 | None |
| A0A484Y8G2 | 31-135 | None |
| A0A7X8JS94 | 11-102 | None |
| A0A377YYF3 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.