DPCstruct | MC23326
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 141 ± 19 aa |
| Standard deviation of domain lengths | 19.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.02 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | PF04347- PF00813 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317IPG1 | 3-139 | IVILLTLMTLLPAALMAITPFLRITIVLHFLRQALGTQSTPSNQVLIGLALFLTIVIVQPVAADIYHLGWEPLQDGRLSPQQAFDQG… |
| A0A2X3JJ64 | 6-112 | SLPVQTLVFITSLTFIPAILLMMTSFTRIIIVFGLLRNALGTPSAPPNQVLLGLALFLTFFIMSPVIDKIYVDAYQPFSEEKISMQE… |
| W0RBP9 | 322-508 | None |
| A0A7Z2X7U6 | 2-132 | None |
| A0A4Q4XE38 | 242-378 | None |
| A0A1G7KZV0 | 1-159 | None |
| A0A2N2H0E5 | 1-159 | None |
| A0A261WH31 | 5-152 | None |
| A0A258JL55 | 21-158 | None |
| A0A5B8XSH9 | 23-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.