DPCstruct | MC23324
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 106 ± 14 aa |
| Standard deviation of domain lengths | 13.85 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3AAA5 | 1-110 | MIGFNGTSHADESNFSTNKCFRTLTWVAGAHQNHASERVMNDVTLTSRNMDNTVAHAGKYANADALVQDARSSLLDEWHKEADDLVV… |
| A0A7U4S660 | 144-227 | IGFNGKSVEKTTDYETNPNGEDVNKGWHAIMKEWDSGKQIITDPVTLDEQGDYRSLDAMASDLINTKIPQQFRTDPRLVVLAGA |
| S5MP85 | 3-88 | None |
| A0A826JYN9 | 129-247 | None |
| A0A7H4P5N5 | 56-164 | None |
| A0A447PAT8 | 34-151 | None |
| A0A0T9TRN7 | 3-103 | None |
| A0A7H4NYK7 | 1-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.