DPCstruct | MC23321
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 128 ± 9 aa |
| Standard deviation of domain lengths | 8.87 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 15.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H9AQM5 | 21-133 | FILALYFTLKTKKKDISKQFPYAEIVNTTVKTKHLCYIVKNYDDPIKEASYLIKLKNEFPTELGTPYKIPTGTSLRITQAKAFTNGV… |
| A0A7G9TGL3 | 1-119 | MVSYEDVSNDPKYSMHVGTEYRTTSDMTVYRVSMDRNYGPSPSIYTIVQPPGFDGPEVISRTRFPAGSTLKILTIQRCKDCYLDTEP… |
| A0A0Q0H6X8 | 3-120 | None |
| A0A0Q8ELQ5 | 7-144 | None |
| A0A1Q2M6K8 | 7-128 | None |
| A0A7W2IX41 | 18-154 | None |
| A0A1G6CQE8 | 1-129 | None |
| A0A7V8AZF5 | 8-144 | None |
| A0A0A2WLF4 | 22-144 | None |
| K2JPS7 | 52-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.