DPCstruct | MC23320
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 83 ± 7 aa |
| Standard deviation of domain lengths | 7.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7PBH8 | 12-92 | RELRRLPGVGKVIAEDLWNLGLHGVEELAGRDADELYEAHNRYRGAVQDRCMLYVFRCAVYYARTPEEKREPEKLLWWNWK |
| A0A7G6USP4 | 83-167 | AADAATLEDIPNIGPSIAGDLRGVGIATPQDLAHQDPYALYERVNAATGQRHDPCLCDCFIAAVRFMEGGAPTPWWHYIVERKRH |
| A0A348NPX4 | 2-83 | None |
| A0A412E430 | 4-77 | None |
| A0A2G4YX33 | 8-89 | None |
| A0A7X7GZM0 | 5-79 | None |
| S0FAE4 | 108-193 | None |
| A0A350UNR8 | 7-94 | None |
| A0A3D1R6K3 | 71-155 | None |
| A0A847VC79 | 153-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.