DPCstruct | MC23319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 114 ± 24 aa |
| Standard deviation of domain lengths | 23.91 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 73.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 40.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K1J363 | 1-67 | MRDSFTFPAADHARLGELKERALKSGREIKKSELLRAGLAALVAMPDAAFLAALDGVERIKTGRPAK |
| A0A7G6UKL4 | 10-94 | AAGTGTPASADDRPAKLVRDSFTMPADDFALVGVLKGRALQVQRPAKKSELLRAGLHALAGLSPQALARALDALAPVKAGRPKKK |
| A0A2T1C4C9 | 49-126 | None |
| A0A857J336 | 26-145 | None |
| A0A3G2G1E7 | 4-80 | None |
| A0A2N2QUB6 | 1-193 | None |
| A0A6G0ZW96 | 102-232 | None |
| A0A7U7J445 | 33-114 | None |
| A0A0N0JW26 | 65-200 | None |
| A0A1I4YUY6 | 14-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.