DPCstruct | MC23318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 122 ± 17 aa |
| Standard deviation of domain lengths | 16.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3L9M467 | 6-155 | IWLSILFTPLLLLSACNKEPTQSNVPKSTEQTAKTQPNCETTIIQLTPPLREKYAHQVANYINQKVNSNDIQIQKVIEIGLWSAANI… |
| A0A2M6VK39 | 56-162 | NCTRVSFLSAQDPRYLQAKATIQAYSPPQSSSAQLAGVWAAGDWTLAEVEFAQLLPAVVLMHTVNGATAIVPSAVWSGYTQPWKAAP… |
| A0A7Z7YPB8 | 81-206 | None |
| A0A418SY00 | 1-148 | None |
| A0A7W1TNE6 | 287-406 | None |
| A0A315B663 | 45-153 | None |
| A0A248UPY1 | 1-104 | None |
| A0A830TAZ6 | 255-374 | None |
| A0A7G8BWD4 | 1-132 | None |
| A1B6M3 | 1-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.