DPCstruct | MC23317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 219 |
|---|---|
| Mean domain length (aa) | 134 ± 19 aa |
| Standard deviation of domain lengths | 19.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9Y0N9 | 11-133 | GQEFLSCLNQINFGPIAFKLMHPEDGIAWSLEQATEAIEQYRRFLILSYLYSEKIVVPSKIIDRVWHFHILDTAKYRKDCQNLFGQF… |
| A0A6N4RDH1 | 8-136 | TRGVYVMSPNQNRMAVESLDLSNIVTRLQAKEKFDETRAQAAVDMYRQFLAMVQGHPEQIMVPNEDVDAAWHHHILDTQTYARDCEG… |
| A0A819MH36 | 15-187 | None |
| G4TMV2 | 145-295 | None |
| A0A194VSI2 | 174-300 | None |
| A0A817PYX6 | 5-132 | None |
| A0A535YCN0 | 7-131 | None |
| A0A5A8AMJ6 | 12-167 | None |
| A0A819Z8E3 | 65-188 | None |
| A0A842ICT0 | 1-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.