DPCstruct | MC23311
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 106 ± 9 aa |
| Standard deviation of domain lengths | 9.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 72.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 35.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0225 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H5BIZ7 | 1-106 | MVVRPLLRRILSILLLYSVTAAGIAYFAFHGWNGDHGLQAKRGFEIEMARLHEELDAVRAERLAMEKKVALLRPQSLDPDMLDERAR… |
| A0A1T4L116 | 1-99 | MLLRPRQILAPVIFATVFGYFGYHLVNGDRGLLAMVHLQRENQIADQNLAEAEATRKIWERRVSELRNQSIDPDMLDERARILLNYA… |
| A0A3M0ZZ27 | 1-105 | None |
| A0A3M0XSI0 | 1-112 | None |
| A0A2E7HDL5 | 1-111 | None |
| A0A7D5RXI2 | 1-126 | None |
| A0A7T9JT04 | 3-103 | None |
| A0A212QNY1 | 21-121 | None |
| A0A3N1MFV8 | 6-95 | None |
| A0A1V5LF42 | 4-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.