DPCstruct | MC2331
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 5.58 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 93.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 33.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7HH59 | 77-158 | KAKSQYYLKIASQLQTAIDNVLWDEEEGIWFDYDLKTKQHRRMFYPSNLAPLYTRSYNHIQREHYALSAVAYLKSQNIDGFF |
| J9E6F9 | 9-87 | QKAEEFEKKGQEAWKALNAIFYNKLKKAWFDYNLRIKSHNTLFYPTVAMPLFTGCYTMLDYGKSAKVIDFMNKSNVFNY |
| A0A0B2UQN5 | 2-78 | None |
| A0A7R9D1N6 | 608-689 | None |
| A0A3P6QQT2 | 1-80 | None |
| A0A811JR01 | 343-431 | None |
| A0A183EB57 | 2-74 | None |
| A0A1I7T5F7 | 313-402 | None |
| A0A3P6P4C0 | 3-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.