DPCstruct | MC23308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 181 ± 14 aa |
| Standard deviation of domain lengths | 13.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A348N6B6 | 1-168 | MIKLGHAVYDENGKSAGGKKGDQTGKEITVWDYYISGGKKWDYVIRIRDEAKRDLFARKILAACKNDKIGYDQWVRTSLYNEAKKNN… |
| A0A1Y4M3F4 | 5-178 | IGHASIDENGGVHGGTPGDQNGKEVFKQNWWDWGWTVLLRPVEANIGEKIADACEAGCDNDKIGYSWDDRNSLRTQAQKVGFDLSKI… |
| A0A351V9U2 | 1-188 | None |
| A0A3E2NFX6 | 2-183 | None |
| A0A174JX56 | 191-375 | None |
| A0A1M7YBV2 | 1-200 | None |
| A0A417QWV7 | 1-170 | None |
| R6ML36 | 1-193 | None |
| A0A1I7FGQ8 | 1-184 | None |
| A0A1C5RZF8 | 207-411 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.