DPCstruct | MC23306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 128 ± 15 aa |
| Standard deviation of domain lengths | 15.49 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4MLS6 | 2-125 | SDDSYKFQKLTPFSDVELGVYKNAIDFVFANDDLKNVAISGQYSAGKSSLVESYKKSHSNIKFVHISLAHFRAMEETETNEPSKDIN… |
| A0A2K4QCU0 | 1-98 | MEKNFESLTPKNDIDISTYEEALSFALAEKTITNIALTGPYGAGKSSVIESYKMKHPEKGFMNISLTHFEGNEATGTNILEGKIINQ… |
| A0A4C3B961 | 22-139 | None |
| A0A485D3E5 | 9-153 | None |
| A0A254UIP4 | 7-149 | None |
| A0A1I1V3T8 | 3-149 | None |
| A0A3M7LFR8 | 1-123 | None |
| A0A5P0WQ62 | 63-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.