DPCstruct | MC23304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 104 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444KYQ0 | 4-94 | LAALSFVGTDASGDYPKVVPWQPKRSGDYGRDCAAGRSYYVELHNLMLLENNPTFLARVISAQVAGGVWEGVEIGFTQAMAERLLAA… |
| A0A1G3KB15 | 8-95 | KMSPAACLPFVIVDQETGKVANFWNVNPSGDYADDCETGRAFAYDLIDHIADTQFTGIFDRVTDAMPRGDARTGIERGFCHVFAAAAA |
| A0A7W6YKK9 | 55-160 | None |
| A0A545ZBX0 | 2-117 | None |
| A0A3A0EWY9 | 17-117 | None |
| A0A530Z2Q1 | 92-206 | None |
| A0A178HTX3 | 120-224 | None |
| Q1MC86 | 5-114 | None |
| V4R1U7 | 9-102 | None |
| A0A7W3Q9K2 | 1-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.